PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G28310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 311aa    MW: 34020.7 Da    PI: 9.411
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G28310.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.8e-382383262
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                 ++ +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  AT1G28310.1 23 PQPQLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVK 83
                 67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.3E-332681IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-272781IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9012781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MQSKNMIVAS SHQQQQQQQP QQPQPQLKCP RCDSSNTKFC YYNNYSLSQP RHFCKACKRY  60
WTRGGTLRNV PVGGSYRKNK RVKRPSTATT TTASTVSTTN SSSPNNPHQI SHFSSMNHHP  120
LFYGLSDHMS SCNNNLPMIP SRFSDSSKTC SSSGLESEFL SSGFSSLSAL GLGLPHQMSH  180
DHTINGSFIN NSTTNKPFLL SGLFGSSMSS SSTLLQHPHK PMNNGGDMLG QSHLQTLASL  240
QDLHVGGNNE DMKYKEGKLD QISGNINGFM SSSSSLDPSN YNNMWNNASV VNGAWLDPTN  300
NNVGSSLTSL I
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G28310
AtGenExpressAT1G28310
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G28310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G28310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210440.0AC021044.5 Arabidopsis thaliana chromosome I BAC F3H9 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031100.10.0Dof zinc finger protein DOF1.4
SwissprotQ9FZA40.0DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLQ2V4K70.0Q2V4K7_ARATH; Dof zinc finger protein DOF1.4
STRINGAT1G28310.20.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Ayele M, et al.
    Whole genome shotgun sequencing of Brassica oleracea and its application to gene discovery and annotation in Arabidopsis.
    Genome Res., 2005. 15(4): p. 487-95
    [PMID:15805490]